PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000809640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 287aa    MW: 32682.3 Da    PI: 6.053
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000809640genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.53.5e-091864347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                      WT+eE + +  a +++  +   +W+++a++++ g+t+ +++  +q++
    MDP0000809640 18 EWTKEENKMFESALAMFDEKtpdRWRKVAEMIP-GKTEIDVIKQYQDL 64
                     6********************************.***********986 PP

2Myb_DNA-binding40.65.9e-13119163347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r    ++t+ q+ s+ qky
    MDP0000809640 119 PWTPEEHRRFLLGLLKYGKGDWRNISRNYVVTKTPTQVASHAQKY 163
                      7*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.4E-61567IPR001005SANT/Myb domain
SuperFamilySSF466897.9E-121772IPR009057Homeodomain-like
PROSITE profilePS500906.7131765IPR017877Myb-like domain
CDDcd001671.11E-71864No hitNo description
Gene3DG3DSA:1.10.10.603.0E-41861IPR009057Homeodomain-like
PfamPF002497.4E-81864IPR001005SANT/Myb domain
PROSITE profilePS5129417.375111168IPR017930Myb domain
SuperFamilySSF466893.23E-16114168IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-17115167IPR006447Myb domain, plants
SMARTSM007175.3E-9116166IPR001005SANT/Myb domain
CDDcd001673.54E-9119164No hitNo description
Gene3DG3DSA:1.10.10.601.1E-9119163IPR009057Homeodomain-like
PfamPF002491.7E-10119163IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
METLYPASNM ADYDWYSEWT KEENKMFESA LAMFDEKTPD RWRKVAEMIP GKTEIDVIKQ  60
YQDLEEDVCE IESGRFPIPP GYPQSYFTLE LGDDRDFNAN RKRPAAARGS DQERKRGIPW  120
TPEEHRRFLL GLLKYGKGDW RNISRNYVVT KTPTQVASHA QKYFMRQDSG GKDKRRPSIH  180
DITTVNLTSN TPPETNRSPS DQSPPEQKST ESPNVLLDWN EADDGGAAMV FGSTHGNLLD  240
PSPYDVPADG IKMQLQKLYS HAHYAAHATP QNSLYLMQSA RHQIHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-1419791171RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.259670.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008392914.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-88DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLD9ZJ701e-176D9ZJ70_MALDO; MYBR domain class transcription factor
STRINGVIT_13s0019g03370.t011e-121(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.22e-87MYB family protein